PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G25130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 271aa    MW: 31084 Da    PI: 10.646
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G25130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.6e-312072254
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                     prlrWt eLH++Fv+a++ LGG++kAtPk il+lm+v gLt++hvkSHLQ+YR
  OPUNC02G25130.1 20 PRLRWTAELHRSFVRAIDCLGGQQKATPKLILQLMDVRGLTISHVKSHLQMYR 72
                     8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-291673IPR009057Homeodomain-like
PROSITE profilePS5129411.0771676IPR017930Myb domain
SuperFamilySSF466892.33E-151872IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-222072IPR006447Myb domain, plants
PfamPF002492.1E-62172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGISGERKGV ARQYNRSKVP RLRWTAELHR SFVRAIDCLG GQQKATPKLI LQLMDVRGLT  60
ISHVKSHLQM YRGTRHDKGQ KDMQLQLHLK KHSFGSDEQS PKEFMCPPIK RAKVGTEPSG  120
KYRCMQGSSD MRSSAPPAGT RYFIDDCMRL EEVSMDRRRS DQHDAAAAAR ARAPAAATSS  180
LHQALGFWVQ GRREEPFMVH QISKPIAHQL NHMVRNRKIS CKENHESRFF MSLFMMLLLI  240
SADLVSCETP SKLWLVSLWM SDYIVIIRSR Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0041601e-141AP004160.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1197_E09.
GenBankAP0041881e-141AP004188.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1493_H11.
GenBankAP0149581e-141AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-141CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624520.11e-152PREDICTED: uncharacterized protein LOC107276067
TrEMBLA0A0E0K3G50.0A0A0E0K3G5_ORYPU; Uncharacterized protein
STRINGORGLA02G0236600.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.15e-31G2-like family protein